Camps for kids with learning disabilities

Find camps with learning disability support listed below

Find camps for kids with learning disabilities. Camps across Ontario and Quebec specialize in helping children with specific learning disabilities including Asperger's syndrome, dyslexia, and other disorders. Learn more from the camps below about the environment they create and the facilities they offer to help your learning disabled child. Read more




List of learning support camps and programs

Loading filters, please wait.
 FILTERS
LOADING: Filters will activate shortly, please wait.
  FILTERS
  FILTERS


Any cost
Any age
Any date

Any type

  • Dance (multi)
  • Fantasy (multi)
  • Visual Arts (multi)
  • Science (multi)


Camps below specialize in helping kids with learning challenges. Some camps listed may only have sessions where intense support is available. Take a closer look at listings to get all the details.

FEATURED
  • Traditional (multi activity)
  • Overnight Camp

An award winning Christian summer camp in Muskoka for ages 5 to 17 featuring dozens of awesome activities, teen programs in leadership development and wilderness adventure & unforgettable experiences for every camper! Read more...

  • Ages 5 to 17
  • Coed, Girls, Boys
  • from $450
ropescoursewildernessskillsvocaltrainingsingingmusicmultiartscraftsvisualartsmultidrawingpaintingphotographynatureenvironmentarcherybaseballsoftballballsportsmultibasketballbmxmotocrossextremesportsmultiboardsailingwatersportsmulticanoeingcheercyclingdivingfishingfootballhikingkayakingseakayakingmountainbikingrockclimbingskateboardingsoccersportsinstructionalandtrainingswimmingvolleyballvideographywildernessouttrippingtraditionalmultiactivityovernightcampcoedallgirlsallboys4505-17HuntsvilleOntario2021-07-012021-08-01

Shadow Lake Centre   

Whitchurch - Stouffville

  • Traditional (multi activity)
  • Day Camp, Overnight Camp, Virtual Program

A summer camp for children, youth, and adults with intellectual/developmental disabilities. Accessible activities that include sports, swimming, arts and crafts, and lots of music. Read more...

  • Ages 9 to 65
  • Coed
  • from $1,800
bakingdecoratingcookingartscraftsvisualartsmulticanoeingwatersportsmultidivingswimmingwildernessskillsballetdancemultiballroombreakdancinghiphopjazzmagicperformingartsmultigleemusicmultiguitarjamcampvocaltrainingsingingdrawingpaintingreadingnatureenvironmentbaseballsoftballballsportsmultibasketballfishingfootballhikinghockeykayakingseakayakingsoccerultimatefrisbeevolleyballyogatechnologymusicrecordingmusicaltheatresuperheromarveldcfantasymultifashiondesignmakeupartistrytheatreartsphotographycircusactingfilmtvmarinebiologysciencemultizoologytraditionalmultiactivitydaycampovernightcampvirtualprogramcoed18009-65Whitchurch - StouffvilleOnlineOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01
  • Traditional (multi activity)
  • Virtual Program

A central Ontario summer camp for families and children with Autism Spectrum Disorder. The KOC is located in Minden, Ontario. Situated on 600 hectares of land nestled in the forest along the shores of Grey Lake. Read more...

  • Ages 1 to 21
  • Coed
  • from $1
wildernessskillsdungeonsanddragonsfantasymultibakingdecoratingcookingsuperheromarveldcguitarmusicmultijamcampmusicaltheatreperformingartsmultitheatreartssculpturestarwarsartscraftsvisualartsmultidrawingpaintingphotographyminecrafttechnologycreativewritinglegomathengineeringsciencemultisafarispacezoologysteamstemvideographyanimalstraditionalmultiactivityvirtualprogramcoed11-21MindenOnlineOntario2021-06-012021-07-012021-08-01

Camp Robin Hood   

Markham

  • Traditional (multi activity)
  • Day Camp

A traditional day camp with superb camper-to-staff ratios, a variety of activities, outstanding spirit and well-trained staff! Daily swim instruction, a dedicated Sports Academy and optional bus transportation available. Read more...

  • Ages 4 to 15
  • Coed
  • from $1,295
firstaidlifesavingzoologysciencemultileadershiptrainingleadershipmulticitlitprogramlegoarcherybaseballsoftballballsportsmultibasketballcanoeingwatersportsmultigolfgymnasticshorsebackridingequestriansoccerswimmingtennisvolleyballskateboardingextremesportsmultidivingrockclimbinggagaartscraftsvisualartsmultimusicrecordingmusicmultitheatreartsperformingartsmultipaintingcookinggleevocaltrainingsingingballetdancemultijazzdrawingpotteryguitarhiphopbreakdancingmusicaltheatreropescoursewildernessskillsceramicsanimalsfootballhockeyultimatefrisbeetraditionalmultiactivityleadershipmultidaycampcoed12954-15MarkhamOntario2021-07-012021-08-01

COOKSMART   

Bloor West Village, Toronto; Mississauga

  • Arts: Cooking
  • Day Camp, Virtual Program

Get the kids cooking and learning more life skills! Our program has gone virtual and the kids are loving cooking together to make tasty foods for their family. Easy meals, healthy snacks make this the best Zoom class. Read more...

  • Ages 4 to 99
  • Coed
  • from $5
bakingdecoratingcookingstemphotographyvisualartsmultiprogrammingmultitechnologytheatreartsperformingartsmultimathnatureenvironmentmindfulnesstrainingnutritionartsartsmulticookingdaycampvirtualprogramcoed54-99Bloor West Village, TorontoMississaugaOnlineOntarioWest-End2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-012022-06-012022-07-012022-08-012022-09-012022-10-012022-11-012022-12-01

Camp Kodiak   

Parry Sound

  • Traditional (multi activity)
  • Overnight Camp

Fun! Friends! Success! An integrated overnight summer camp for children & teens with and without LD, ADHD, and high-functioning ASD. We provide a SOCIAL SKILLS program, ACADEMIC program and 50+ activities. Read more...

  • Ages 6 to 18
  • Coed
  • from $1,527
ropescoursewildernessskillsbakingdecoratingcookingjazzdancemultisuperheromarveldcfantasymultiguitarmusicmultivocaltrainingsingingmagicperformingartsmultimusicaltheatretheatreartsartscraftsvisualartsmulticomicartdrawingpaintingphotographypotterywoodworkinginstructorleadgroupacademictutoringmultiinstructorleadoneononecitlitprogramleadershipmultimathnatureenvironmentreadingstemwritingfirstaidlifesavingmindfulnesstrainingstrengthandconditioningcanoeingwatersportsmultifishingkayakingseakayakingsailingmarineskillsswimmingwaterskiingwakeboardingarcherybadmintonbaseballsoftballballsportsmultibasketballfencinggagahikinghorsebackridingequestrianlacrossemartialartspingpongrockclimbingsoccertennisultimatefrisbeevolleyballyogavideographyceramicsjournalismgolftraditionalmultiactivityovernightcampcoed15276-18Parry SoundOnlineOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01

Learning Disabilities Society   

North Vancouver; Vancouver

  • Education (multi)
  • Program, Virtual Program

Programs provide customized, one-to-one or small group learning support for children and youth with diagnosed or suspected learning differences. Read more...

  • Ages 8 to 18
  • Coed
  • from $15
instructorleadgroupacademictutoringmultimathwritinginstructorleadoneononereadingeducationmultiacademictutoringmultiprogramclassvirtualprogramcoed158-18North VancouverVancouverOnlineBritish Columbia2021-09-012021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-012022-06-01

Ruth Rumack's Learning Space   

Annex, Toronto; Davisville Village, Toronto; Deer Park, Toronto

  • Education: Academic/Tutoring (multi)
  • Virtual Program

Cutting-edge Direct Instruction and academic support centre in Toronto offering 1-to-1 individual support for students K-12, innovative group classes and standardized test preparation for SSAT, SAT, and ACT. Read more...

  • Ages 4 to 18
  • Coed
  • from $300
creativewritinginstructorleadgroupacademictutoringmultiinstructorleadoneononewritingreadingjournalismmatheducationeducationmultiacademictutoringmultiacademictutoringmultivirtualprogramcoed3004-18Annex, TorontoDavisville Village, TorontoDeer Park, TorontoOnlineOntarioMidtown, Uptown2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01



Camps below have a generalized population of campers, while offering some support for kids with learning disabilities.

FEATURED

InterVarsity Circle Square Ranch Big Clear Lake   

Hamilton; Huntsville; Land O' Lakes Tourist Region

  • Traditional (multi activity)
  • Overnight Camp

Circle Square Ranch is a life changing Christian summer camp for kids and teens ages 6-17. We offer a wide range of activities including horseback riding and water sports. Your summer adventure with friends starts here! Read more...

  • Ages 6 to 17
  • Coed, Girls, Boys
  • from $499
ropescoursesurvivalskillswildernessskillssuperheromarveldcfantasymultiactingfilmtvperformingartsmultitheatreartsartscraftsvisualartsmultidrawingpaintingpotteryleadershiptrainingleadershipmultifirstaidlifesavingcanoeingwatersportsmultifishingkayakingseakayakingswimmingwaterskiingwakeboardingarcherybasketballballsportsmultidodgeballflagfootballgagahikinghockeyhorsebackridingequestrianmountainbikingextremesportsmultirockclimbingskateboardingsoccersportsinstructionalandtrainingvolleyballyogaceramicsbakingdecoratingpercussionmusicmultiultimatefrisbeemathskilledtradesactivitieswritingstrengthandconditioningjournalismtraditionalmultiactivityovernightcampcoedallgirlsallboys4996-17HamiltonHuntsvilleLand O' Lakes Tourist RegionOnlineOntario2021-07-012021-08-01
FEATURED
  • Education: STEM
  • Virtual Program

30+ STEAM activities, academic courses to develop each child's inner innovative thinking. Robotics, AI, Coding (Java, Arduino, HTML, Python) Math, Abacus, University prep courses, open to the world and Canada Fr/En. Read more...

  • Ages 4 to 18
  • Coed
  • from $190
artscraftsvisualartsmulticartooningdrawingpaintingaiartificialintelligenceanimationarduinoprogrammingmultijavapythonroboticsscratchtechnologywebdesigninstructorleadgroupacademictutoringmultiinstructorleadoneononecreditcoursesmathengineeringsciencemultisteamstemtestpreparation3ddesignwebdevelopmentvideogamedesignarchitecturegamingcvideogamedevelopmentvirtualrealitylanguageinstructionwritingeducationeducationmultistemvirtualprogramcoed1904-18MississaugaOnlineOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-012022-06-01
FEATURED

Pedalheads Bike, Swim and Sport   

Throughout Alberta, British Columbia, Ontario, Quebec (140)

  • Sport: Cycling
  • Day Camp, Program

Pedalheads offers bike, swim, and trail programs to families across Canada. Pedalheads helps kids develop life skills, confidence, and independence through fun, safe, and engaging instruction. Read more...

  • Ages 2 to 12
  • Coed
  • from $199
cyclingsportsinstructionalandtrainingbadmintonbaseballsoftballballsportsmultibasketballgymnasticshockeysoccertrackandfieldmountainbikingextremesportsmultisuperheromarveldcfantasymultiarcheryswimmingwatersportsmultibmxmotocrossrockclimbingsportssportmulticyclingextremesportsmultiwatersportsmultidaycampprogramclasscoed1992-12Bathurst Manor/Clanton Park, TorontoBayview Village, TorontoBloor West Village, TorontoDon Mills, TorontoEast York, TorontoForest Hill, TorontoHumber Valley Village, TorontoLansing , TorontoLawrence Manor, TorontoLeaside, TorontoLittle Italy, TorontoParkview Hills, TorontoRouge, TorontoThe Beach, TorontoWest Deane Park, TorontoAirdrieAjaxBarrieBurlingtonBurnabyCalgaryCoquitlamCote Saint-LucDeltaEdmontonHamiltonHampsteadKelownaKitchenerLangleyLavalLondonMarkhamMiltonMississaugaMont-RoyalMontrealNewmarketNorth VancouverOakvilleOkotoksOttawaOutremontPointe-ClairePort MoodyRichmondRichmond HillSaint LaurentSherwood ParkSpruce GroveSt AlbertSurreyVancouverVaughanVictoriaWaterlooWest VancouverWestmountWhitbyOnlineAlberta, British Columbia, Ontario, QuebecDowntown, East-End, East-York, Etobicoke, Midtown, North-York, Scarborough, West-End2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01
FEATURED

Radiant Girls   

Burlington; Tillsonburg

  • Traditional (multi activity)
  • Overnight Camp, Day Camp

Girls Wellness & Leadership programs, with prof. coaches, chef's and trainers. Featuring Yoga/Pilates, Outdoor Adventures, Art, Leadership Games, Relationship Building, Self Care, Coaching, and More! Read more...

  • Ages 7 to 18
  • Girls
  • from $180
ropescoursewildernessskillsartscraftsvisualartsmultidrawingpaintingphotographycitlitprogramleadershipmultileadershiptrainingsocialjusticesupercampnatureenvironmentwritingmeditationmindfulnesstrainingnutritionpilatesstrengthandconditioningweightlossprogramhikingparkouryogaziplinevideographyempowermentjournalismfilmmakingpapiermachepublicspeakingtraditionalmultiactivityovernightcampdaycampallgirls1807-18BurlingtonTillsonburgOnlineOntario2022-07-012022-08-01
FEATURED

Muskoka Woods   

Rosseau

  • Traditional (multi activity)
  • Overnight Camp

Muskoka Woods is a Christian youth development organization that offers a fun, safe and welcoming environment for all youth. Our staff share a common desire to help young people realize their full potential. Read more...

  • Ages 6 to 16
  • Coed
  • from $1,149
ropescoursebakingdecoratingcookingjazzdancemultifashiondesignmakeupartistryguitarmusicmultiartscraftsvisualartsmultidrawingpaintingphotographypotterystrengthandconditioningcanoeingwatersportsmultifishingkayakingseakayakingsailingmarineskillsswimmingwaterskiingwakeboardingarcherybadmintonbasketballballsportsmultigagagolfgymnasticshockeypaintballpingpongrockclimbingskateboardingextremesportsmultisoccersportsinstructionalandtrainingtennisultimatefrisbeevolleyballziplinetraditionalmultiactivityovernightcampcoed11496-16RosseauOnlineOntario2021-07-01
FEATURED
  • Traditional (multi activity)
  • Day Camp

Located on our beautiful 60-acre lakeside campus in southwest Oakville, Appleby Summer Programs offer a wide variety of day camp, enrichment and credit program options for campers and students ages 4-17. Read more...

  • Ages 4 to 17
  • Coed
  • from $435
canoeingwatersportsmultiswimmingbasketballballsportsmultidiscgolfdodgeballflagfootballgolfrockclimbingrugbysoccersportsinstructionalandtrainingtennisvolleyballtechnologyvideogamedesignstemdrawingvisualartsmultipaintingmagicperformingartsmultimusicaltheatretheatreartsartscraftscartooningcomicartsewingtraditionalmultiactivitydaycampcoed4354-17OakvilleOnlineOntario2021-06-012021-07-012021-08-01
FEATURED
  • Traditional (multi activity)
  • Day Camp, Overnight Camp

Overnight and day camps, with activities including horsemanship, swimming, high ropes, climbing wall, archery, campfires, tomahawks, and much more. Leadership and horse specialty camps also offered. Read more...

  • Ages 5 to 16
  • Coed, Girls, Boys
  • from $240
archeryhorsebackridingequestrianswimmingwatersportsmultitrampolinerockclimbinggagaballsportsmultiartscraftsvisualartsmultiropescoursebadmintonsoccervolleyballziplinebasketballhikingtraditionalmultiactivitydaycampovernightcampcoedallgirlsallboys2405-16BrantfordOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01
FEATURED

Outward Bound Canada   

North Toronto, Toronto; Algonquin Park; Huntsville; Kananaskis; Vancouver Island

  • Adventure (multi)
  • Day Camp, Overnight Camp

Outward Bound Canada provides challenging adventures in the outdoors across the country that develop self-respect, awareness of others, interpersonal skills, and a sense of accomplishment. Read more...

  • Ages 12 to 99
  • Coed, Girls, Boys
  • from $779
ropescoursewildernessouttrippingwildernessskillscookingphotographyvisualartsmultiinstructorleadgroupacademictutoringmultileadershiptrainingleadershipmultisocialjusticenatureenvironmentwritingfirstaidlifesavingmindfulnesstrainingcanoeingwatersportsmultiswimminghikingvideographyempowermentjournalismcreditcourseskayakingseakayakingsurfingtraveladventuremultidaycampovernightcampcoedallgirlsallboys77912-99North Toronto, TorontoAlgonquin ParkHuntsvilleKananaskisVancouver IslandAlberta, British Columbia, OntarioUptown2021-07-012021-08-01
FEATURED
  • Adventure: Wilderness Out-tripping
  • Overnight Camp

Wilderness canoe adventures with heart & meaning in boys, girls and all-gender programs. Trips weave together challenge, community & confidence to connect youth to the land, each other, and their own unique spirit. Read more...

  • Ages 10 to 17
  • Coed, Girls, Boys
  • from $1,500
travelwildernessouttrippingwildernessskillscookingleadershiptrainingleadershipmultimindfulnesstrainingcanoeingwatersportsmultifishinghikingadventureadventuremultiwildernessouttrippingwatersportsmultiovernightcampcoedallgirlsallboys150010-17TemagamiOntario2021-06-012021-07-01
FEATURED

Glen Bernard Camp   

Huntsville

  • Traditional (multi activity)
  • Overnight Camp

A traditional overnight summer camp for girls offering wilderness adventure, horseback riding, sailing, swimming and lifesaving, arts and many other activities! Read more...

  • Ages 4 to 16
  • Girls
  • from $1,325
ropescoursewildernessouttrippingwildernessskillscookingguitarmusicmultivocaltrainingsingingtheatreartsperformingartsmultiartscraftsvisualartsmultidrawingpaintingphotographypotterywoodworkingcreditcoursesnatureenvironmentbronzecrossfirstaidlifesavingboardsailingwatersportsmulticanoeingkayakingseakayakingsailingmarineskillsswimmingarcherybaseballsoftballballsportsmultibasketballgolfhikinghorsebackridingequestrianmountainbikingextremesportsmultirockclimbingsoccertennistrampolineyogaziplinevideographyceramicsvolleyballtraditionalmultiactivityovernightcampallgirls13254-16HuntsvilleOnlineOntario2021-06-012021-07-01
FEATURED

Great Big Theatre Company   

Throughout Ontario (12)

  • Arts: Theatre Arts
  • Day Camp, Program, Virtual Program

Camps in your neighbourhood ! One-week sessions, performances every week. Our experienced, caring staff will introduce your kids to stage performance & guide them toward self-expression. A great confidence-builder ! Read more...

  • Ages 4 to 14
  • Coed
  • from $98
jazzdancemultivocaltrainingsingingmusicmultimusicaltheatreperformingartsmultisetandcostumedesigntheatreartsplaywritingartscraftsvisualartsmultidrawingartsartsmultitheatreartsperformingartsmultidaycampprogramclassvirtualprogramcoed984-14York Mills, TorontoBurlingtonGuelphHamiltonLondonMississaugaOakvilleRichmond HillWaterlooWhitbyOnlineOntarioNorth-York2021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-012022-01-01
FEATURED

Sidney Ledson Institute   

Don Mills, Toronto

  • Traditional (multi activity)
  • Virtual Program

The SLI Summer Camp offers: Pre-K/K reading/numeracy program, Math/ English enrichment, Debate, Entrepreneurship, Comp Sci (HTML/CSS, Machine Learning/AI, App Development, R, Python), French, Spanish, and SSAT/ISEE prep. Read more...

  • Ages 2.5 to 14
  • Coed
  • from $420
programmingmultitechnologywebdesigninstructorleadgroupacademictutoringmultiinstructorleadoneononeentrepreneurshiplanguageinstructionsocialjusticeleadershipmultimathpublicspeakingreadingzoologysciencemultistemtestpreparationwritingdebateempowermentwebdevelopmentjournalismanimalstraditionalmultiactivityvirtualprogramcoed4202.5-14Don Mills, TorontoOnlineOntarioNorth-York2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01
FEATURED

Kandalore   

Minden

  • Traditional (multi activity)
  • Overnight Camp

Kandalore is one of the finest overnight camps in Canada, providing the best of both canoe tripping and in-camp activities. For 74 years, Kandalore has given campers the chance to get to know and be themselves fully. Read more...

  • Ages 6 to 16
  • Coed
  • from $2,780
hockeyskiingextremesportsmultirockclimbingropescoursewildernessskillstraditionalmultiactivityextremesportsmultiovernightcampcoed27806-16MindenOnlineOntario
FEATURED

Onondaga Camp   

Minden

  • Traditional (multi activity)
  • Overnight Camp

For more than 100 years Onondaga Camp has provided an inclusive environment where young people can play, explore, achieve and grow. Offering over 30 different activities, there is something for everyone! Read more...

  • Ages 6 to 16
  • Coed
  • from $1,500
ropescourseballetdancemultijazzmusicaltheatreperformingartsmultitheatreartsartscraftsvisualartsmultidrawingpaintingpotterywoodworkingcreditcoursesfirstaidlifesavingarcherybaseballsoftballballsportsmultibasketballcanoeingwatersportsmultifishinggolfhockeyhorsebackridingequestriankayakingseakayakingmountainbikingextremesportsmultirockclimbingsailingmarineskillsskateboardingsoccerswimmingtennisultimatefrisbeewaterskiingwakeboardingyogaziplineceramicstraditionalmultiactivityovernightcampcoed15006-16MindenOnlineOntario2021-08-01
FEATURED
  • Arts: Visual Arts (multi)
  • Program

The McMichael provides an unmatched backdrop for children, youth and family programs. For details on Virtual Programs, Children's Camps, Art Classes, Accessible Studio Workshops and Family Days visit mcmichael.com today! Read more...

  • Ages 5 to 15
  • Coed
  • from $90
artscraftsvisualartsmultiphotographypaintingdrawingartsartsmultivisualartsmultiprogramclasscoed905-15VaughanOnlineOntario
FEATURED

The Maker Bean Cafe   

Dufferin Grove, Toronto; Wallace Emerson, Toronto

  • Computer (multi)
  • Day Camp, Program

Creative technology camps to engage your kids & teen. Topics include Robotics, Inventions, Minecraft & Video Game Programming. Read more...

  • Ages 6 to 12
  • Coed
  • from $95
superheromarveldcfantasymultiartscraftsvisualartsmultidrawingpaintingwoodworkinganimationprogrammingmultiminecrafttechnologywebdesignvideogamedesignroboticsinstructorleadgroupacademictutoringmultiinstructorleadoneononeentrepreneurshipmakerspacemathnatureenvironmentarchitecturesciencemultiengineeringlegoskilledtradesactivitiesstembasketballballsportsmultisoccerharrypotter3dprintingaiartificialintelligencearduinojavapythonscratchsteam3ddesignwebdevelopmentfashiondesignsculpturemechatronicsrasberrypivirtualrealitysewingcomputermultidaycampprogramclasscoed956-12Dufferin Grove, TorontoWallace Emerson, TorontoOnlineOntarioDowntown, West-End2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-01

Oxford Learning High Park   

Bloor West Village, Toronto

  • Education (multi)
  • Day Camp, Program

Oxford means a personalized learning experience for your child. Veriety of programs for the students of all ages. Learning takes a fun turn. Our students are excited to learn! Read more...

  • Ages 4 to 12
  • Coed
  • from $100
cookingjazzdancemultitheatreartsperformingartsmultiartscraftsvisualartsmultidrawingpaintingtechnologyinstructorleadgroupacademictutoringmultiinstructorleadoneononelanguageinstructionmathpublicspeakingreadingnatureenvironmentlegoroboticszoologysciencemultistemwritingmindfulnesstraininghikingyogaprogrammingmultiengineeringcomedycartooningcomicartcreativewritingleadershiptrainingleadershipmultimarinebiologydebatejournalismanimalsballethealthsciencesteamtestpreparationvocaltrainingsingingmusicmultisocialjusticenutritionempowermenteducationmultiacademictutoringmultidaycampprogramclasscoed1004-12Bloor West Village, TorontoOnlineOntarioWest-End2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-012022-06-012022-07-012022-08-012022-09-012022-10-012022-11-012022-12-012023-01-012023-02-012023-03-012023-04-012023-05-012023-06-012023-07-012023-08-012023-09-012023-10-012023-11-012023-12-012024-01-012024-02-012024-03-012024-04-012024-05-012024-06-012024-07-012024-08-012024-09-012024-10-012024-11-012024-12-012025-01-012025-02-012025-03-012025-04-012025-05-012025-06-012025-07-012025-08-01

Innova STEM Labs   

Mississauga

  • Education: STEAM
  • Virtual Program

STEAM based camp and workshops •3D Design and Printing •Robotics • Mechatronics •Virtual & Augmented Reality •Internet Of Things (IoT) • Computer programming •Video Game Design Read more...

  • Ages 5 to 18
  • Coed, Girls, Boys
  • from $25
aiartificialintelligencedronetechnologyscratchprogrammingmultieducationeducationmultisteamvirtualprogramcoedallgirlsallboys255-18MississaugaOntario2021-02-01
  • Computer (multi)
  • Virtual Program

Artech is the Ultimate Creative Technology Program Center specializing in Game Design, Animation & Coding. Our virtual programs are fully interactive for kids 7 through teens and can reach kids anywhere on this planet! Read more...

  • Ages 7 to 19
  • Coed
  • from $150
drawingvisualartsmultiaiartificialintelligenceanimationminecrafttechnologyvideogamedesigninstructorleadgroupacademictutoringmultiinstructorleadoneononemathengineeringsciencemultisteamstem3ddesigncreativewritingpublicspeakingdebatesuperheromarveldcfantasymulticomicartpythonprogrammingmulticartooningvirtualrealitylegorobloxsetandcostumedesignperformingartsmultiactingfilmtvplaywritingfilmmakingphotographyvideographyscratchwritingjournalismcomputermultiprogrammingmultivirtualprogramcoed1507-19HalifaxOnlineNova Scotia2021-07-012021-08-012021-09-012021-10-012021-11-012021-12-01
  • Traditional (multi activity)
  • Day Camp

The Town of Oakville offers fun and affordable camps to suit any taste including arts, adventure, theatre, sports and more! Enjoy Summer, March Break, P.A. Day and Holiday camps. Programs offered for children aged 4-14. Read more...

  • Ages 4 to 12
  • Coed
  • from $157
actingfilmtvperformingartsmulticookinghiphopdancemultijazzgleemusicmultimusicaltheatretheatreartsartscraftsvisualartsmultidrawingpaintingphotographywoodworkinganimationroboticscitlitprogramleadershipmultisafarisciencemultizoologystemstrengthandconditioningbadmintonbasketballballsportsmulticyclinggolfhockeyiceskatingrockclimbingskateboardingextremesportsmultisoccerswimmingwatersportsmultitennisvolleyballtraditionalmultiactivitydaycampcoed1574-12OakvilleOnlineOntario

Sports Camps Canada   

High Park, Toronto; North Toronto, Toronto; Calgary; Vancouver

  • Sport (multi)
  • Day Camp

Our coed summer sports camps are geared toward kids ages 4-18 of all abilities and skill levels. From beginner to elite, there is a camp option for everyone. Improve Your Skills & Have SERIOUS FUN at Sports Camps Canada! Read more...

  • Ages 4 to 17
  • Coed
  • from $235
basketballballsportsmultigagasoccertennissportmultidaycampcoed2354-17High Park, TorontoNorth Toronto, TorontoCalgaryVancouverAlberta, British Columbia, OntarioUptown, West-End
  • Traditional (multi activity)
  • Day Camp

A co-ed summer day camp close to the city offering camp activities for any child: traditional camp, sports camp, golf camp, tennis camp or leadership training. Read more...

  • Ages 4 to 14
  • Coed
  • from $780
sportsinstructionalandtrainingtennisballsportsmulticookinghiphopdancemultisuperheromarveldcfantasymultiharrypottergleemusicmultitheatreartsperformingartsmultiartscraftsvisualartsmultiphotographyvideogamedesignroboticscitlitprogramleadershipmultileadershiptrainingnatureenvironmentlegozoologysciencemultiarcherybaseballsoftballbasketballgagahockeymartialartsrockclimbingswimmingwatersportsmultiultimatefrisbeevolleyballvideographyanimalstraditionalmultiactivityballsportsmultileadershipmultidaycampcoed7804-14Richmond HillOntario2021-07-012021-08-01

Silver Lake Mennonite Camp   

Throughout Ontario (17)

  • Traditional (multi activity)
  • Day Camp

Find your next adventure here. Now offering Adventures Day Camps in 13 locations across Ontario plus Overnight camp and Family Cabin Rentals in Sauble Beach. Read more...

  • Ages 5 to 16
  • Coed
  • from $195
survivalskillswildernessskillsstorytellingartscraftsvisualartsmultinatureenvironmentswimmingwatersportsmultihikingsocialjusticeleadershipmulticanoeingsoccerballsportsmultigagaempowermentleadershiptrainingdiscgolfultimatefrisbeevolleyballtraditionalmultiactivitydaycampcoed1955-16The Beach, TorontoGuelphHamiltonHanoverKitchenerLeamingtonLondonNorthern Wellington CountyOttawaSauble BeachSt. CatharinesWaterlooWest NipissingOnlineOntarioEast-End2021-07-012021-08-01
  • Arts: Comedy
  • Virtual Program

The Second City's totally digital, totally FUN comedy camps will engage your children for four hours of fun and creativity -- with other kids! Read more...

  • Ages 7 to 18
  • Coed
  • from $250
comedytheatreartsperformingartsmultiplaywritingartsartsmulticomedyvirtualprogramcoed2507-18Online2021-06-012021-07-01
  • Education: Academic/Tutoring (multi)
  • Virtual Program

The Progressive Centre is a tutoring agency that provides educational support programs for students in all subject areas and grades. We offer in-home and online tutoring programs for students in the GTA. Read more...

  • Ages 4 to 16
  • Coed
  • from $400
instructorleadgroupacademictutoringmultimathreadingwritingjournalismeducationeducationmultiacademictutoringmultivirtualprogramcoed4004-16AjaxOnlineOntario2021-08-01

Camp Solelim   

Lawrence Manor, Toronto; Sudbury

  • Traditional (multi activity)
  • Overnight Camp

Camp Solelim is a sleepover camp designed for Jewish 13 to 15 year olds. Our programming includes traditional waterfront, sports, arts and outdoor activities, as well as leadership development and community building. Read more...

  • Ages 13 to 15
  • Coed
  • from $7,385
survivalskillstravelwildernessouttrippingwildernessskillsbakingdecoratingcomedycookingbreakdancingdancemultihiphopjazzgleemusicmultiguitarjamcamppianosongwritingvocaltrainingsingingmusicaltheatreperformingartsmultisetandcostumedesigntheatreartsplaywritingartscraftsvisualartsmultipaintingleadershiptrainingleadershipmultisocialjusticesteamstemwritingbronzecrossfirstaidlifesavingmeditationmindfulnesstrainingstrengthandconditioningboardsailingwatersportsmulticanoeingkayakingseakayakingswimmingwaterskiingwakeboardingbaseballsoftballballsportsmultibasketballdodgeballflagfootballhikinghockeysoccersportsinstructionalandtrainingtrackandfieldultimatefrisbeevolleyballwaterpoloyogaempowermentjournalismtraditionalmultiactivityovernightcampcoed738513-15Lawrence Manor, TorontoSudburyOntarioNorth-York2021-07-012021-08-01

Bayview Glen Camp   

Don Mills, Toronto; York Mills, Toronto

  • Traditional (multi activity)
  • Day Camp

Located centrally in Toronto, this summer camp boasts ample outdoor greenspace, a full size turf sports field, and air conditioned buildings. They offer specialized sports, arts, and coding/robotics camps. Read more...

  • Ages 4 to 14
  • Coed
  • from $2,300
ropescoursebakingdecoratingcookingballetdancemultibreakdancinghiphopjazzmagicperformingartsmultigleemusicmultiguitarmusicrecordingmusicaltheatretheatreartsartscraftsvisualartsmultidrawingpaintingphotographypotterywoodworkingprogrammingmultitechnologyroboticscitlitprogramleadershipmultileadershiptrainingnatureenvironmentlegoarcherybaseballsoftballballsportsmultibasketballcyclingfootballgagagolfgymnasticshikinghockeyhorsebackridingequestriankaratelacrossemartialartsmountainbikingextremesportsmultipingpongrockclimbingrugbyskateboardingsoccersportsinstructionalandtrainingswimmingwatersportsmultitennistrampolineultimatefrisbeevolleyballtraditionalmultiactivitydaycampcoed23004-14Don Mills, TorontoYork Mills, TorontoOnlineOntarioNorth-York
  • Education (multi)
  • Day Camp, Program, Virtual Program

At Sylvan of Oakville, we have STEM Summer Camps, STEM Club, tutoring in JK-Gr. 12 math, reading, and writing, as well as SAT/ACT prep courses. Read more...

  • Ages 5 to 18
  • Coed
  • from $30
roboticsengineeringsciencemultilegostemvideogamedesigntechnologyanimationwebdesignprogrammingmultilanguageinstructionjournalismmathreadingtestpreparationwritinginstructorleadgroupacademictutoringmultieducationmultiacademictutoringmultidaycampprogramclassvirtualprogramcoed305-18OakvilleOnlineOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-01

Block 8 Academy   

Port Moody

  • Traditional (multi activity)
  • Day Camp

Camps, classes and preschool that are Active, Creative, and a Mix of Indoor and Outdoor! From lake days to art/drama classes, abacus math to music - we have a balanced curriculum that keeps the kids engaged. Read more...

  • Ages 5 to 12
  • Coed
  • from $45
storytellingbakingdecoratingcomedycookinghiphopdancemultijazzsuperheromarveldcfantasymultiharrypottermusicrecordingmusicmultipercussionsongwritingvocaltrainingsingingactingfilmtvperformingartsmultimagicmusicaltheatresetandcostumedesigntheatreartsplaywritingartscraftsvisualartsmulticartooningcomicartdrawingfilmmakingknittingandcrochetpaintingpapiermachephotographypotteryanimationtechnologyentrepreneurshipfinancialliteracysocialjusticeleadershipmultilegomathnatureenvironmentpublicspeakingreadingengineeringsciencemultistemmindfulnesstrainingswimmingwatersportsmulticheergymnasticshikingyogafashiondesignsculpturestarwarscreativewritingleadershiptraininghealthsciencemarinebiologyspacezoologysteamwritingmeditationnutritionbadmintondodgeballballsportsmultiparkoursoccertrackandfieldtraditionalmultiactivitydaycampcoed455-12Port MoodyOnlineBritish Columbia2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-01

Laurus Summer Camp   

Throughout Quebec (6)

  • Traditional (multi activity)
  • Day Camp

Montreal, Laval and Beaconsfield's #1 Lifestyle Summer day camp! We blend fun, education & specialty training in arts, academics and sports! Weekly program for kids ages 3 - 15! Registration is open in November for 2020! Read more...

  • Ages 3 to 15
  • Coed
  • from $150
bakingdecoratingcookingbreakdancingdancemultihiphopjazzsuperheromarveldcfantasymultipercussionmusicmultisongwritingvocaltrainingsingingmagicperformingartsmultitheatreartsartscraftsvisualartsmultidrawingpaintingroboticsvideogamedesignentrepreneurshiplanguageinstructionleadershiptrainingleadershipmultimathnatureenvironmentmarinebiologysciencemultisafarispacezoologystemmindfulnesstrainingnutritionstrengthandconditioningbasketballballsportsmultihockeysoccersportsinstructionalandtrainingyogaprogrammingmulticitlitprogramfirstaidlifesavingmartialartsanimalsstorytellingmusicaltheatreplaywritingphotographyinstructorleadgroupacademictutoringmultisocialjusticesupercampfootballvideographyempowermenttraditionalmultiactivityleadershipmultidaycampcoed1503-15BeaconsfieldLavalMontrealWestmountOnlineQuebec2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01

Silver Lake Wesleyan Camp   

Western Lanark County

  • Traditional (multi activity)
  • Overnight Camp

A Christian camp serving campers of all ages. Located on beautiful Silver Lake in Maberly, ON we offer Junior & Kids Camps (7-12yo), Day Camps (4-6yo), Youth Camp (12-18), Family Camp (All Ages) and Geezer Camp (60+). Read more...

  • Ages 1 to 99
  • Coed
  • from $479
wildernessskillscanoeingwatersportsmultifishingkayakingseakayakingswimmingwaterskiingwakeboardingarcherybaseballsoftballballsportsmultidodgeballgagahikingsoccerultimatefrisbeevolleyballtraditionalmultiactivityovernightcampcoed4791-99Western Lanark CountyOnlineOntario2021-06-012021-07-012021-08-01

Wilvaken   

Magog

  • Traditional (multi activity)
  • Overnight Camp

Bilingual (Fr/En) summer experience with water and land sports: sailing, water-skiing, windsurfing, archery, hiking/canoeing out trips and more. Spend the summer with campers from around the world! Read more...

  • Ages 6 to 15
  • Coed
  • from $2,450
wildernessskillsguitarmusicmultitheatreartsperformingartsmultiartscraftsvisualartsmultidrawingpaintingnatureenvironmentboardsailingwatersportsmulticanoeingfishingkayakingseakayakingsailingmarineskillsswimmingwaterskiingwakeboardingarcherybadmintonbasketballballsportsmultihikingpingpongsoccertennisvolleyballtraditionalmultiactivityovernightcampcoed24506-15MagogQuebec2021-06-012021-07-01

The Michelangelo Code   

Brampton; Mississauga; Vaughan

  • Computer: Video Game Design
  • Program, Virtual Program

With valuable contributions from Industry leaders, Mr. G, a STEM Instructor and former GANZ game developer passes on key techniques used by his production team! Read more...

  • Ages 5 to 18
  • Coed
  • from $150
superheromarveldcfantasymultimodelingperformingartsmultiartscraftsvisualartsmultidrawingpaintinganimationprogrammingmultiminecrafttechnologywebdesignvideogamedesignsupercampleadershipmultimatharchitecturesciencemultizoologystemwritingmindfulnesstraining3ddesigncomputerstechnologycomputermultivideogamedesignprogramclassvirtualprogramcoed1505-18BramptonMississaugaVaughanOnlineOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-01
  • Traditional (multi activity)
  • Overnight Camp

Supportive & therapeutic environment for struggling students. Assessment, educational support, life skills and outdoor activities. Earn school credit, acquire skills & stay safe! Read more...

  • Ages 11 to 18
  • Girls, Boys
  • from $1
instructorleadgroupacademictutoringmultiinstructorleadoneononebaseballsoftballballsportsmultibasketballsoccercyclingmountainbikingextremesportsmultigymnasticshikinghorsebackridingequestrianrockclimbingcanoeingwatersportsmultikayakingseakayakingswimmingtraditionalmultiactivityovernightcampallgirlsallboys111-18BarrieRed DeerOnlineAlberta, Ontario2021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-01
  • Traditional (multi activity)
  • Virtual Program

Explore unique science and tech programs at Ontario Tech, including LEGO, Coding, Minecraft and more! Virtual camps will require minimal parent support once the camp site has been successfully accessed. Read more...

  • Ages 6 to 17
  • Coed
  • from $90
legodrawingvisualartsmultipaintingphotographywoodworkinganimationroboticstechnologyvideogamedesignwebdesignnatureenvironmentarchitecturesciencemultiengineeringsteam3ddesignvideographywebdevelopmentartscraftsprogrammingmultimathmakerspacezoologystemanimalstraditionalmultiactivityvirtualprogramcoed906-17OshawaOnlineOntario2021-07-012021-08-01
  • Arts (multi)
  • Day Camp, Overnight Camp

SummerArts combines the best of camp with the best of the arts, with great food, a full rec schedule, campfire, and of course a core of incredible arts programming, all on a beautiful campus overlooking the Bay of Fundy. Read more...

  • Ages 5 to 18
  • Coed
  • from $290
wildernessskillsactingfilmtvperformingartsmultijazzdancemultisuperheromarveldcfantasymultifashiondesignvocaltrainingsingingmusicmultimusicaltheatretheatreartsartscraftsvisualartsmultidrawingpaintingphotographypotteryanimationwebdesignvideogamedesignroboticsmakerspacenatureenvironmentarchitecturesciencemultiengineeringlegomarinebiologyzoologyskilledtradesactivitiesstemwritingfootballgagaballsportsmultisoccer3ddesignsewingvideographyceramicswebdevelopmentjournalismanimalshikingballetinstructorleadgroupacademictutoringmulticitlitprogramleadershipmultileadershiptrainingsocialjusticemusicrecordinggleejamcampguitarpianoartsmultidaycampovernightcampcoed2905-18CanningOnlineNova Scotia2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01

Cedar Ridge Camp   

Bancroft

  • Traditional (multi activity)
  • Overnight Camp

Cedar Ridge Camp is a wonderful place where campers have the opportunity to get outside and develop friendships. Read more...

  • Ages 6 to 16
  • Coed
  • from $900
firstaidlifesavingleadershiptrainingleadershipmultiarcherybaseballsoftballballsportsmultibasketballcanoeingwatersportsmulticyclingfishinghikinghockeyhorsebackridingequestriankayakingseakayakingmountainbikingextremesportsmultiwhitewaterraftingsailingmarineskillssoccerswimmingvolleyballsportsinstructionalandtrainingtrackandfieldyogadivingrockclimbingpingponggagabadmintonfootballartscraftsvisualartsmultimusicrecordingmusicmultitheatreartsperformingartsmultiphotographypaintinggleejamcampballetdancemultijazzdrawingguitarpianowildernessouttrippingropescoursewildernessskillsvideographytraditionalmultiactivityovernightcampcoed9006-16BancroftOnlineOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-01

Camp Oconto   

Sharbot Lake

  • Traditional (multi activity)
  • Overnight Camp

Founded in 1924, Oconto is a traditional girls overnight camp located on the beautiful shores of Eagle Lake north of Kingston, Ontario. Over 20 activities are offered on 80 acres of land and 2km of shoreline. Read more...

  • Ages 4 to 16
  • Girls
  • from $1,280
firstaidlifesavingarcherybaseballsoftballballsportsmultibasketballboardsailingwatersportsmulticanoeingfishinghikinghorsebackridingequestriankayakingseakayakingsailingmarineskillssoccerswimmingtennisvolleyballsportsinstructionalandtrainingdivingrockclimbingbadmintonartscraftsvisualartsmultitheatreartsperformingartsmultipaintingvocaltrainingsingingmusicmultijazzdancemultidrawingpotteryguitarpianowildernessouttrippingropescoursewildernessskillsbronzecrossceramicstraditionalmultiactivityovernightcampallgirls12804-16Sharbot LakeOnlineOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-01

Young People's Theatre/YPT   

St Lawrence, Toronto

  • Arts: Theatre Arts
  • Virtual Program

Led by our experienced faculty of professional artist educators, we’re offering a wide selection of online classes for toddlers to teens, plus in-person options for youth. Read more...

  • Ages 1 to 18
  • Coed
  • from $44
vocaltrainingsingingmusicmultiactingfilmtvperformingartsmultimusicaltheatresetandcostumedesigntheatreartsartsartsmultitheatreartsperformingartsmultivirtualprogramcoed441-18St Lawrence, TorontoOnlineOntarioDowntown2021-04-012021-05-012021-06-012021-07-012021-08-01
  • Education: STEM
  • Virtual Program

uOttawa Engineering Outreach offers a wide range of programs in engineering, science, technology, and coding for both kids and teens. From summer camps to clubs and afterschool programs, as well as credited courses. Read more...

  • Ages 5 to 17
  • Coed, Girls
  • from $20
technologyengineeringsciencemultihealthsciencemarinebiologymedicalsciencezoologysteamstemanimalseducationeducationmultistemvirtualprogramcoedallgirls205-17OttawaOnlineOntario2021-07-012021-08-01

Medeba Summer Camp   

Haliburton

  • Traditional (multi activity)
  • Overnight Camp

Medeba Summer Camp is an overnight camp that uses adventure and community to provide the best week of your child's summer! We provide a full range of traditional and extensive adventure activities to choose from. Read more...

  • Ages 7 to 16
  • Coed
  • from $729
ropescoursetravelwildernessskillsartscraftsvisualartsmultipotterywoodworkingarcherybaseballsoftballballsportsmultibasketballcanoeingwatersportsmultigagahikingkayakingseakayakingmountainbikingextremesportsmultirockclimbingsoccerswimmingtrampolineultimatefrisbeevolleyballziplinetraditionalmultiactivityovernightcampcoed7297-16HaliburtonOnlineOntario

Toronto Kidz   

Baby Point, Toronto; High Park, Toronto; Roncesvalles Village, Toronto

  • Traditional (multi activity)
  • Day Camp

Each week focuses on a theme such as Dinosaurs, Animals, etc. for our younger campers and Science, Fitness, Arts, etc. for our 8-12 year olds. Field trips to Toronto's main attractions are the highlight of the week. Read more...

  • Ages 5 to 12
  • Coed
  • from $213
engineeringsciencemultihealthsciencemarinebiologyspacezoologysteamstemmeditationmindfulnesstrainingnutritionstrengthandconditioningbaseballsoftballballsportsmultibasketballdodgeballhikingparkoursocceryogawildernessouttrippingwildernessskillsartscraftsvisualartsmultitraditionalmultiactivityperformingartsmultivisualartsmultidaycampcoed2135-12Baby Point, TorontoHigh Park, TorontoRoncesvalles Village, TorontoOntarioWest-End, York-Crosstown2021-07-012021-08-01
  • Education: Instructor lead (group)
  • Day Camp, Virtual Program

The Cognitive Intensive Program strengthens the Symbol Relations cognitive function. Strengthening this area means a more powerful and positive capacity to understand, participate in and contribute to the world. Read more...

  • Ages 8 to 88
  • Coed
  • from $5,000
instructorleadgroupacademictutoringmultiinstructorleadoneononeeducationeducationmultiinstructorleadgroupdaycampvirtualprogramcoed50008-88South Hill, TorontoOnlineOntarioMidtown2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01
  • Traditional (multi activity)
  • Overnight Camp

Nature based summer day and overnight camp led by Ontario Certified Teachers. Spend days outdoors exploring ponds, creeks, wetlands meadows and forests! Read more...

  • Ages 4 to 12
  • Coed
  • from $200
creditcoursestraditionalmultiactivityovernightcampcoed2004-12PickeringOnlineOntario

York University; Science Engagement   

Bathurst Manor/Clanton Park, Toronto; Sentinel Park, Toronto

  • Education: STEM
  • Day Camp, Program

Science Engagement Programs offers interactive and hands-on STEM experiences for youth in grade 3-12. Elementary programs include Science Saturdays, March Camp, and SciX. Secondary programs include Helix and Spark Lab. Read more...

  • Ages 8 to 18
  • Coed, Girls
  • from $70
roboticstechnologymathnatureenvironmentarchitecturesciencemultiengineeringhealthsciencemarinebiologymedicalsciencesafarispacezoologysteamstemanimalsvideogamedesignprogrammingmultiwebdesigneducationeducationmultistemdaycampprogramclasscoedallgirls708-18Bathurst Manor/Clanton Park, TorontoSentinel Park, TorontoOnlineOntarioNorth-York2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01

Camp Pathfinder   

Algonquin Park

  • Traditional (multi activity)
  • Overnight Camp

Est. 1914. A traditional boys' summer camp, island campus in Algonquin. Full in-camp program. Water, land and camp skills. Wilderness canoe trips, Spectacular setting. Exceptional staff. Positive masculine culture. Fun! Read more...

  • Ages 7 to 16
  • Boys
  • from $1,200
firstaidlifesavingwritingnatureenvironmentleadershiptrainingleadershipmulticitlitprogrampublicspeakingreadingarcherybaseballsoftballballsportsmultibasketballcanoeingwatersportsmultifishinghikingkayakingseakayakingmountainbikingextremesportsmultisailingmarineskillssoccerswimmingvolleyballsportsinstructionalandtrainingbadmintonziplineultimatefrisbeephotographyvisualartsmultiwildernessouttrippingropescoursewildernessskillstraveldivingvideographydebatejournalismtraditionalmultiactivityovernightcampallboys12007-16Algonquin ParkOnlineOntario2021-07-012021-08-01

Rockstar Music   

Annex, Toronto; Vaughan

  • Arts: Music (multi)
  • Program

Learn from the comfort of home. Discover a new way to learn music while building confidence, creativity and leadership skills. Book a free trial with a Rockstar instructor today! Read more...

  • Ages 1 to 100
  • Coed
  • from $30
pianomusicmultimusicalinstrumenttrainingsongwritingvocaltrainingsingingartsartsmultimusicmultimusicmultiprogramclasscoed301-100Annex, TorontoVaughanOnlineOntarioMidtown2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-01

Camp Tanamakoon   

Algonquin Park

  • Traditional (multi activity)
  • Overnight Camp

This all girls summer camp located on its own lake in Algonquin Park offers a variety of camp activities, along with specialty programs for canoe tripping, mini camp and kindercamp! We offer a safe and fun adventure! Read more...

  • Ages 4 to 16
  • Girls
  • from $2,975
ropescoursewildernessouttrippingcookingguitarmusicmultipianomusicaltheatreperformingartsmultitheatreartsartscraftsvisualartsmultidrawingpaintingphotographypotterywoodworkingarcherybaseballsoftballballsportsmultibmxmotocrossextremesportsmultiboardsailingwatersportsmulticheercyclingfigureskatingfishinggymnasticshikingkayakingseakayakingmountainbikingsailingmarineskillssoccersportsinstructionalandtrainingswimmingtennisvolleyballyogatraditionalmultiactivityovernightcampallgirls29754-16Algonquin ParkOnlineOntario

Camp Cherith - Ontario   

Southern Bruce County

  • Traditional (multi activity)
  • Overnight Camp

This Christian camp includes focuses on theatre arts, horseback riding, canoe tripping and more, situated in the heart of Grey-Bruce in south central Ontario. Read more...

  • Ages 6 to 16
  • Coed
  • from $519
ropescoursewildernessskillsvocaltrainingsingingmusicmultiartscraftsvisualartsmultidrawingwoodworkingcitlitprogramleadershipmultileadershiptrainingnatureenvironmentcanoeingwatersportsmultifishingkayakingseakayakingswimmingarcherybasketballballsportsmultigagahikinghorsebackridingequestrianmountainbikingextremesportsmultisoccertrampolinevolleyballsportsinstructionalandtrainingtheatreartsperformingartsmultipaintingcookingguitartraditionalmultiactivityovernightcampcoed5196-16Southern Bruce CountyOnlineOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01

Kidz Kamp Inc.   

Halton Hills; Mississauga

  • Traditional (multi activity)
  • Day Camp

A traditional outdoor day camp, with fun activities, friends, exciting field trips and outstanding memories! Now offering March Break, Summer & Winter Break Equestrian Camp at our new second location in Georgetown! Read more...

  • Ages 5 to 16
  • Coed
  • from $95
artscraftsvisualartsmultidrawingpaintingbaseballsoftballballsportsmultibasketballhorsebackridingequestriansoccerswimmingwatersportsmultitraditionalmultiactivitydaycampcoed955-16Halton HillsMississaugaOntario

Roseneath Theatre   

Downtown West, Toronto

  • Traditional (multi activity)
  • Virtual Program

A creative collection of programs that range from Dance, Drama, ASL Improv, our popular Dungeons & Dragons programs and more. Our expert councillors bring the arts to kids computers in fun and accessible ways. Read more...

  • Ages 6 to 16
  • Coed
  • from $40
actingfilmtvperformingartsmultitheatreartsmusicaltheatresetandcostumedesignplaywritingstorytellingsuperheromarveldcfantasymultiharrypottercreativewritingmathpublicspeakingreadingdebatemagiccomedycircusbreakdancingdancemultihiphopfashiondesignmakeupartistrymodelingartscraftsvisualartsmultiphotographysocialjusticeleadershipmultiyoutubevloggingstarwarswritingjournalismtraditionalmultiactivityperformingartsmultifantasymultivirtualprogramcoed406-16Downtown West, TorontoOntarioDowntown2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01

Families in the Spotlight   

Gabriola; Jasper; Montreal

  • Arts: Musical Theatre
  • Day Camp, Overnight Camp

Kids in the Spotlight is an evidence-based performing arts organization helping children and youth develop self-confidence, social skills, and harmonious relationships with family and friends. Read more...

  • Ages 3 to 100
  • Coed
  • from $800
actingfilmtvperformingartsmultiballetdancemultiballroombreakdancinghiphopjazzvocaltrainingsingingmusicmultimusicaltheatretheatreartsartscraftsvisualartsmultiphotographyleadershiptrainingleadershipmultimindfulnesstrainingiceskatingartsartsmultimusicaltheatreperformingartsmultidaycampovernightcampcoed8003-100GabriolaJasperMontrealOnlineAlberta, British Columbia, Quebec
  • Sport: Cycling
  • Program

Courses for ages 4 and up from the never-ever to advanced bicycling and summer day camps for kids. Professional, fun instructors ensure your bicycling skills improve so that you can safely ride your bike for any purpose. Read more...

  • Ages 4 to 99
  • Coed
  • from $80
travelcyclingsportssportmulticyclingprogramclasscoed804-99CalgaryAlberta2021-05-012021-06-012021-07-012021-08-01

Kettleby Valley Camp   

Newmarket

  • Traditional (multi activity)
  • Day Camp

Located just north of Toronto, this traditional summer camp offers overnight, day and canoe trip programs for campers 8 to 14. Read more...

  • Ages 8 to 14
  • Coed
  • from $575
ropescoursewildernessouttrippingwildernessskillsartscraftsvisualartsmulticitlitprogramleadershipmulticanoeingwatersportsmultikayakingseakayakingswimmingarcheryrockclimbingtraditionalmultiactivitydaycampcoed5758-14NewmarketOntario2021-07-012021-08-01

Bond Academy Day Camp   

The Beach, Toronto

  • Traditional (multi activity)
  • Day Camp

Day camps can include care from 7 a.m. to 6 p.m., should parents require this. Activities range from arts to science and many more. Read more...

  • Ages 4 to 13
  • Coed
  • from $250
bakingdecoratingcookingtheatreartsperformingartsmultiartscraftsvisualartsmultidrawingpaintingpotterybadmintonbasketballballsportsmultisoccertraditionalmultiactivitydaycampcoed2504-13The Beach, TorontoOnlineOntarioEast-End

Science North Camps   

Throughout Ontario (7)

  • Education: STEM
  • Day Camp, Virtual Program

Science North offers innovative and stimulating summer day camps and virtual camps that introduce children to the worlds of science, technology, engineering and math. Camps are available for 4-11 year olds. Read more...

  • Ages 4 to 12
  • Coed
  • from $153
roboticstechnologystemsocialjusticeleadershipmultinatureenvironmentengineeringsciencemultimedicalsciencespacezoologyempowermentanimalsdrawingvisualartsmultisupercampmathmagicperformingartsmultitheatreartsartscraftsmarinebiologylegoarchitecturesafarieducationeducationmultistemdaycampvirtualprogramcoed1534-12City of Thunder BayKenoraNorth BaySault Ste MarieSudburyOnlineOntario2021-07-012021-08-01

Kilcoo Camp   

Moore Park, Toronto; Minden

  • Traditional (multi activity)
  • Overnight Camp

Kilcoo has an earned reputation as one of Canada's foremost traditional summer camps. Boys come to Kilcoo to enjoy the activities, to gain confidence in themselves, to learn to work with others and to "just have fun"! Read more...

  • Ages 7 to 16
  • Boys
  • from $2,975
ropescoursewildernessouttrippingwildernessskillstheatreartsperformingartsmultiartscraftsvisualartsmultipotterywoodworkingfirstaidlifesavingstrengthandconditioningarcherybaseballsoftballballsportsmultibasketballboardsailingwatersportsmulticanoeingfishingfootballgagahikinghockeykayakingseakayakingmountainbikingextremesportsmultipingpongrockclimbingsailingmarineskillssoccerswimmingtennisultimatefrisbeevolleyballwhitewaterraftingtraditionalmultiactivityovernightcampallboys29757-16Moore Park, TorontoMindenOnlineOntarioMidtown

The Pine Project   

Bloor West Village, Toronto; East York, Toronto; Leslieville, Toronto

  • Education: Nature/Environment
  • Day Camp, Overnight Camp, Program

Ontario's leading nature connection organization, offering year-round outdoor education programs for youth. Time in nature makes kids smarter, happier, and healthier. Join us for weekly adventures this school year! Read more...

  • Ages 1 to 16
  • Coed
  • from $460
wildernessskillsartscraftsvisualartsmultiwoodworkingleadershiptrainingleadershipmultinatureenvironmentzoologysciencemultimindfulnesstrainingstrengthandconditioninghikingcookingcitlitprogramarcherycanoeingwatersportsmultifishingswimmingeducationeducationmultinatureenvironmentdaycampovernightcampprogramclasscoed4601-16Bloor West Village, TorontoEast York, TorontoLeslieville, TorontoOntarioEast-End, East-York, West-End2021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-012022-06-012022-07-012022-08-01

Bear Creek Outdoor Centre   

Ottawa; Renfrew

  • Traditional (multi activity)
  • Overnight Camp

We are a small camp with a spectacular community of campers and staff. We focus on having a great time building interpersonal skills and connecting with each other in a fantastic natural setting. Read more...

  • Ages 6 to 17
  • Coed
  • from $675
ropescoursewildernessouttrippingwildernessskillsbakingdecoratingcookingsuperheromarveldcfantasymultiartscraftsvisualartsmultidrawingpaintingcitlitprogramleadershipmultileadershiptrainingnatureenvironmentfirstaidlifesavingmindfulnesstrainingstrengthandconditioningarcherybadmintonbaseballsoftballballsportsmulticanoeingwatersportsmulticricketcyclingfishinggagagymnasticshikingkayakingseakayakingmountainbikingextremesportsmultirockclimbingsoccersportsinstructionalandtrainingswimmingtrackandfieldvolleyballwhitewaterraftingtraditionalmultiactivityovernightcampcoed6756-17OttawaRenfrewOntario2021-07-012021-08-01
  • Computer: Programming (multi)
  • Program

World class coding and robotics curriculum for kids. After-school programs, Camps, Birthday Parties and much more. Virtual Classes also available. Read more...

  • Ages 5 to 18
  • Coed, Girls
  • from $150
storytellingyoutubevloggingsuperheromarveldcfantasymultimusicrecordingmusicmultiartscraftsvisualartsmulticartooningdrawingphotographyroblox3dprintingaiartificialintelligenceanimationarduinoprogrammingmultijavapythondronetechnologymechatronicsminecraftrasberrypiroboticsscratchtechnologyvideogamedesignvirtualrealitywebdesignlegomakerspacesteamstem3ddesignvideographywebdevelopmentfilmmakingpaintingcomputerstechnologycomputermultiprogrammingmultiprogramclasscoedallgirls1505-18MississaugaOnlineOntario2021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-01
  • Traditional (multi activity)
  • Day Camp, Overnight Camp

A traditional Christian Camp, located in Prince Edward County just across the lake from Sandbanks Provincial Park. Read more...

  • Ages 5 to 14
  • Coed
  • from $225
travelarcherybaseballsoftballballsportsmultibasketballcanoeingwatersportsmultigagakayakingseakayakingsoccerswimmingvolleyballartscraftsvisualartsmultiultimatefrisbeefootballwaterskiingwakeboardingcitlitprogramleadershipmultileadershiptrainingmindfulnesstrainingtraditionalmultiactivitydaycampovernightcampcoed2255-14PictonOnlineOntario

Rooks to Cooks   

Bayview Village, Toronto; Little Italy, Toronto; Markland Wood, Toronto

  • Arts: Cooking
  • Day Camp, Virtual Program

Engaging, educational and fun! We offer unique, intensive virtual cooking programs for kids, ages 7+. Kids learn to cook, but they also learn about nutrition, team-work, problem-solving and much more! Read more...

  • Ages 6 to 16
  • Coed
  • from $160
bakingdecoratingcookingartscraftsvisualartsmultinutritionartsartsmulticookingdaycampvirtualprogramcoed1606-16Bayview Village, TorontoLittle Italy, TorontoMarkland Wood, TorontoOnlineOntarioDowntown, Etobicoke, North-York2021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01
  • Sport: Basketball
  • Program

Higher Training Basketball Academy, offering: group, private and semi private skills based basketball training. During the holiday's we offer large group basketball classes and travel for tournaments too! Read more...

  • Ages 4 to 18
  • Coed
  • from $36
basketballballsportsmultitennissportssportmultibasketballballsportsmultiprogramclasscoed364-18BurlingtonOntario2021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-012022-06-012022-07-012022-08-012022-09-012022-10-012022-11-012022-12-012023-01-012023-02-012023-03-012023-04-012023-05-012023-06-012023-07-012023-08-012023-09-012023-10-012023-11-012023-12-012024-01-012024-02-012024-03-012024-04-012024-05-012024-06-012024-07-012024-08-012024-09-012024-10-012024-11-012024-12-012025-01-012025-02-012025-03-012025-04-012025-05-012025-06-012025-07-012025-08-012025-09-012025-10-012025-11-012025-12-012026-01-012026-02-012026-03-012026-04-012026-05-012026-06-012026-07-012026-08-012026-09-012026-10-012026-11-012026-12-012027-01-012027-02-012027-03-012027-04-012027-05-012027-06-012027-07-012027-08-012027-09-012027-10-012027-11-012027-12-012028-01-012028-02-012028-03-012028-04-012028-05-012028-06-012028-07-012028-08-012028-09-012028-10-012028-11-012028-12-012029-01-012029-02-012029-03-012029-04-012029-05-012029-06-012029-07-012029-08-012029-09-012029-10-012029-11-012029-12-012030-01-012030-02-012030-03-012030-04-012030-05-012030-06-012030-07-012030-08-012030-09-01

SportLife   

Montreal; Pierrefonds; Sainte-Anne-de-Bellevue

  • Sport (multi)
  • Day Camp

A unique team sports camp, simulating the career of professional athletes! Sports include: ice hockey, flag/touch football, basketball, soccer, baseball, ball hockey and much more! Read more...

  • Ages 5 to 15
  • Coed
  • from $150
baseballsoftballballsportsmultibasketballfootballhockeyiceskatinglacrossesoccerswimmingwatersportsmultitennisvolleyballsportsinstructionalandtrainingsportmultidaycampcoed1505-15MontrealPierrefondsSainte-Anne-de-BellevueQuebec2021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01

Extra Ed   

Downtown West, Toronto

  • Education (multi)
  • Program, Virtual Program

Camps and online, on-site, and at school educational programs in Coding, Financial Literacy, Chess, Creative Writing, Arts, Lego, Lego Robotics and more. Created and taught by certified teachers and experts. Read more...

  • Ages 5 to 18
  • Coed
  • from $38
guitarmusicmultimusicrecordingmusicalinstrumenttrainingpianocreativewritingchessinstructorleadgroupacademictutoringmultiinstructorleadoneononefinancialliteracylanguageinstructionmathnatureenvironmentpublicspeakingreadingengineeringsciencemultihealthsciencemarinebiologymedicalsciencespacesteamstemtestpreparationwritingdebatejournalismeducationmultiacademictutoringmultiprogramclassvirtualprogramcoed385-18Downtown West, TorontoOnlineOntarioDowntown2021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-012022-06-012022-07-012022-08-012022-09-012022-10-012022-11-012022-12-01
  • Traditional (multi activity)
  • Overnight Camp

A co-ed overnight camp on 200 acres in Poland, Maine. Campers enjoy an elective program with 100+ choices that focuses on instruction and skill development in Arts, Athletics, Enrichment, Outdoors and Waterfront. Read more...

  • Ages 7 to 17
  • Coed
  • from $3,100
writingleadershiptrainingleadershipmulticitlitprogrampublicspeakingarcherybaseballsoftballballsportsmultibasketballboardsailingwatersportsmultifishinggolfhikinghorsebackridingequestriankayakingseakayakingmountainbikingextremesportsmultiwhitewaterraftingsailingmarineskillssoccerswimmingtennisvolleyballwaterskiingwakeboardingsportsinstructionalandtrainingtrackandfieldlacrosseyogarugbyrockclimbinggagaziplinefootballultimatefrisbeecricketartscraftsvisualartsmultitheatreartsperformingartsmultiphotographymagicfashiondesignpaintingcookingwoodworkinggleemusicmultijazzdancemultidrawingpotteryguitarbakingdecoratinghiphopharrypotterfantasymultimusicaltheatrewildernessouttrippingropescoursewildernessskillstraditionalmultiactivityovernightcampcoed31007-17MaineOnlineUnited States

Boys & Girls Club of Eastview   

East York, Toronto; Leslieville, Toronto; Riverdale, Toronto

  • Traditional (multi activity)
  • Program

From crafts to sports, education to robotics our programs have a wide variety of activities and trips to keep your children busy and entertained. Read more...

  • Ages 4 to 18
  • Coed
  • from $50
balletdancemultibreakdancinghiphopsuperheromarveldcfantasymultipercussionmusicmultivocaltrainingsingingmagicperformingartsmultimusicaltheatretheatreartssculpturestorytellingartscraftsvisualartsmultidrawingmixedmediapaintingpapiermachelanguageinstructionlegonatureenvironmentreadingsoccerballsportsmultigymnasticsyogainstructorleadgroupacademictutoringmultichesscreativewritingfinancialliteracyjournalismleadershiptrainingleadershipmultimathpublicspeakinganimalssciencemultihealthsciencespacesteamstemwritingnutritionbadmintonbaseballsoftballdodgeballflagfootballsquashtennisvolleyballskateboardingextremesportsmultifootballhikingpingpongtraditionalmultiactivityprogramclasscoed504-18East York, TorontoLeslieville, TorontoRiverdale, TorontoOntarioEast-End, East-York2021-09-012021-10-012021-11-012021-12-012022-01-012022-02-012022-03-012022-04-012022-05-012022-06-012022-07-012022-08-012022-09-012022-10-012022-11-012022-12-012023-01-012023-02-012023-03-012023-04-012023-05-012023-06-012023-07-012023-08-012023-09-01

Mi-A-Kon-Da   

Hamilton; Parry Sound

  • Traditional (multi activity)
  • Overnight Camp

A traditional, all-girls summer camp with various outdoor activities including sailing, wilderness trips, arts and crafts activities and more. Offering 1, 2 or 4 week sessions or an introductory weekend. Read more...

  • Ages 6 to 16
  • Girls
  • from $2,240
firstaidlifesavingarcheryboardsailingwatersportsmulticanoeingfishinghikingkayakingseakayakingmountainbikingextremesportsmultisailingmarineskillsswimmingvolleyballballsportsmultiyogarockclimbingartscraftsvisualartsmultitheatreartsperformingartsmultiphotographypaintingwoodworkingjamcampmusicmultivocaltrainingsingingballetdancemultijazzdrawingguitarpianosuperheromarveldcfantasymultihiphopwildernessouttrippingropescoursewildernessskillsvideographytraditionalmultiactivityovernightcampallgirls22406-16HamiltonParry SoundOntario2021-07-012021-08-01
  • Traditional (multi activity)
  • Day Camp

A STEAM (STEM + Arts) summer camp and before and after-school care provider that offers variety of classes, including coding, cooking, game design, robotics and virtual reality for children ages 4-13. Read more...

  • Ages 4 to 13
  • Coed
  • from $275
scratchprogrammingmultitechnologyvideogamedesigninstructorleadgroupacademictutoringmultinatureenvironmentmarinebiologysciencemultizoologycartooningvisualartsmulticomicartdrawingpaintingpapiermachesteamnutritionbakingdecoratingcookingaviationmakerspacematharchitectureengineeringhealthscienceskilledtradesactivitiesstemlegomedicalscienceyoutubevloggingplaywritingphotographyanimationcreativewritingspacetraditionalmultiactivitysciencemultiprogrammingmultidaycampcoed2754-13PickeringOnlineOntario2021-06-012021-07-012021-08-01

Fraser Lake Camp   

Bancroft; Whitchurch - Stouffville

  • Traditional (multi activity)
  • Overnight Camp

We have a rich history and a rooted community. We provide a variety of land and water sports in a supportive and inclusive environment. Our staff are positive role models and the culture they create is our biggest asset. Read more...

  • Ages 8 to 16
  • Coed
  • from $434
ropescoursewildernessouttrippingwildernessskillsguitarmusicmultipercussionactingfilmtvperformingartsmultiartscraftsvisualartsmulticitlitprogramleadershipmultileadershiptrainingnatureenvironmentbronzecrossfirstaidlifesavingmeditationmindfulnesstrainingbasketballballsportsmultidodgeballgagahikingpingpongrockclimbingsoccervolleyballtraditionalmultiactivityovernightcampcoed4348-16BancroftWhitchurch - StouffvilleOntario2021-07-012021-08-01
  • Education: Academic/Tutoring (multi)
  • Virtual Program

We offer one to one & group online tutoring support in all academic subjects & a variety of enrichment programs, such as learning & wellness strategies, literature, writing, math, science, coding, art, book clubs & more. Read more...

  • Ages 3 to 18
  • Coed
  • from $50
instructorleadgroupacademictutoringmultilanguageinstructionmathreadinghealthsciencesciencemultistemwritingjournalismeducationeducationmultiacademictutoringmultiacademictutoringmultivirtualprogramcoed503-18Online2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-01

Eco Camp    

Orangeville

  • Traditional (multi activity)
  • Day Camp

If you want your child to have fun, learn about the earth and be outside ... you are sending them to the right place!! Your child will come home tired, happy, and probably a little dirty - which we think is perfect!! Read more...

  • Ages 5 to 14
  • Coed
  • from $350
wildernessouttrippingwildernessskillsartscraftsvisualartsmultidrawingpaintingwoodworkingcitlitprogramleadershipmultileadershiptrainingnatureenvironmentcanoeingwatersportsmultifishingarcherydiscgolfhikinglacrosseballsportsmultimountainbikingextremesportsmultisoccervolleyballtraditionalmultiactivitydaycampcoed3505-14OrangevilleOntario2021-07-01

Learning Tree Tutors   

Harbourfront, Toronto

  • Traditional (multi activity)
  • Virtual Program

About Learning Tree Tutors We offer 1-on-1 online tutoring for Grade JK to 12 - English, Reading, Writing, French, Math, Science, Biology, Chemistry, Physics, Computers. (Also In-home service but central Toronto only) Read more...

  • Ages 5 to 18
  • Coed
  • from $40
javaprogrammingmultipythoninstructorleadoneononeacademictutoringmultimathreadingstemtestpreparationtraditionalmultiactivityvirtualprogramcoed405-18Harbourfront, TorontoOnlineOntarioDowntown2021-09-012021-10-012021-11-012021-12-01

The GO Project   

Humber Valley Village, Toronto; Barrie; Oro Medonte

  • Traditional (multi activity)
  • Day Camp

A camp for change makers. Daily crafts, games and activities centred around a theme of giving back to the community and the world... putting faith and love into action. Read more...

  • Ages 6 to 18
  • Coed
  • from $50
puppetrystorytellingtheatreartsperformingartsmultiartscraftsvisualartsmultipaintingsocialjusticeleadershipmultiempowermenttraditionalmultiactivitydaycampcoed506-18Humber Valley Village, TorontoBarrieOro MedonteOntarioEtobicoke2021-07-012021-08-01

Play Island Explorers   

Richmond Hill

  • Traditional (multi activity)
  • Day Camp, Program

Join us for March Break, Summer Camp, & Winter Break for an exciting camp experience for children ages 4-12 years. From indoor playground, outdoor sports, crafts, science, baking, music, splash park, & much more. Read more...

  • Ages 4 to 12
  • Coed
  • from $50
puppetrystorytellingbakingdecoratingcomedycookingmagicperformingartsmultiartscraftsvisualartsmultidrawingpaintingpapiermachepotterylegonatureenvironmentstemswimmingwatersportsmultibaseballsoftballballsportsmultibasketballsoccertrackandfieldvolleyballyogaceramicsinstructorleadgroupacademictutoringmultilanguageinstructionmathreadingknittingandcrochettraditionalmultiactivitydaycampprogramclasscoed504-12Richmond HillOntario2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01
  • Traditional (multi activity)
  • Day Camp

An interactive and exciting summer program with a literacy and math focus in the morning, and arts and games in the afternoon. For children aged 4 through 12. Read more...

  • Ages 4 to 12
  • Coed
  • from $275
artscraftsvisualartsmultidrawingpaintingpotteryinstructorleadgroupacademictutoringmultilanguageinstructionmathreadingtestpreparationwritingceramicsjournalismtraditionalmultiactivitydaycampcoed2754-12MississaugaOntario2021-07-012021-08-01

Active Scholars   

North Toronto, Toronto; Ajax; Guelph

  • Education: STEM
  • Day Camp, PA Day

A unique summer experience, Where Sports Meets Education and campers get to engage in both STEM Learning & Basketball or Soccer Development. Each week we offer a unique experience for continued growth and engagement. Read more...

  • Ages 7 to 13
  • Coed
  • from $235
filmmakingvisualartsmultiphotographyroboticstechnologyvideogamedesignmakerspacesteamstemstrengthandconditioningbadmintonbaseballsoftballballsportsmultibasketballfootballhockeysoccersportsinstructionalandtrainingvolleyballyogalegoarchitecturesciencemultiengineeringvirtualrealitycricketflagfootballmartialartstrackandfieldmathanimationartscraftsaviationeducationeducationmultistemballsportsmultidaycamppadaycoed2357-13North Toronto, TorontoAjaxGuelphOnlineOntarioUptown2021-01-012021-02-012021-03-012021-04-012021-05-012021-06-012021-07-012021-08-01

Code Ninjas Meadowvale   

Mississauga

  • Computer (multi)
  • Program

When school is out, fun and learning are in at Code Ninjas camps! If your kids are into MineCraft, Roblox, robotics, coding, or gaming, Code Ninjas is the place to be! Space is limited – reserve your spot today! Read more...

  • Ages 5 to 14
  • Coed
  • from $150
javaprogrammingmultipythonroboticsscratchtechnologyvideogamedesignwebdesignsteamstemwebdevelopmentcomputermultiprogramclasscoed1505-14MississaugaOntario2021-03-012021-04-012021-05-012021-06-012021-07-012021-08-012021-09-012021-10-012021-11-012021-12-012022-01-01

Children at learning disability camps enjoy the learning experience without some of the frustrations they might feel in regular school or at non-specialized kids camps. A wide range of extracurricular activities adds to the fun and also helps develop motor skills and coordination. Various types of instructional strategies are applied at these camps. Tasks are broken down into manageable chunks and presented in a logical sequence to ensure learning. Since campers are surrounded by supportive peers with related disabilities, they learn quicker and benefit more too. With other children in the same boat, a learning disability camp is a great way to advance without peer pressure or some other stressors associated with being learning disabled. Exciting camp adventures are customized for campers who have learning disabilities so that they can benefit from the activities.

Children with learning disabilities benefit greatly from the atmosphere and life at a learning disabled camp where they feel a sense of belonging and personal growth. Campers live, learn and play with campers in an atmosphere of mutual care and respect. Children and teenagers at these camps experience significant personal growth and better social functioning as reported by parents, teachers and other involved professionals. Studies show that learning disability camps reveal the leadership potential of campers, enhance social skills and create bonds of friendship that can last a lifetime.



Advertisement

In the spotlight:

  • How literate are Canadian students?

    They can read, but when it comes to functional literacy—expressing ideas, crafting arguments—some feel that students could, and should, be doing better. [Read more]


Session Registration:
Child's age:
Date:
Location:

Contact me by:
 Email
 Mail
 Phone


This contact form is brought to you by Our Kids: The trusted source for families since 1998.

By logging in or creating an account, you agree to Our Kids' Terms and Conditions. Information presented on this page may be paid advertising provided by the advertisers [schools/camps/programs] and is not warranted or guaranteed by OurKids.net or its associated websites. By using this website, creating or logging into an Our Kids account, you agree to Our Kids' Terms and Conditions. Please also see our Privacy Policy. Our Kids ™ © 2020 All right reserved.

Sign up to receive our exclusive eNews twice a month.

You can withdraw consent by unsubscribing anytime.


Name

Email

verification image, type it in the box

 


Our Kids  From Our Kids, Canada’s trusted source for private schools, camps, and extracurriculars.
y